PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof018716
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 153aa    MW: 17682.7 Da    PI: 10.4009
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17347072PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l + ++++G g+W+t+++  g+ R++k+c++rw +yl
        Sof018716 14 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-26667IPR009057Homeodomain-like
SuperFamilySSF466897.9E-18767IPR009057Homeodomain-like
PROSITE profilePS5129424.586965IPR017930Myb domain
SMARTSM007176.5E-121363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001671.24E-101761No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSTV PKLAGLQRCG KSCRLRWINY  60
LRPDLKEVHS LRRRKTLSLN FMLYXETGGX QIAQGCXEEL ITRLRFSGNS SIKKKLRQKS  120
IDXNTHKPXA EXDTANNSTI STERPLSPRC DLX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.90550.0crown| inflorescence| root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967646.11e-56PREDICTED: transcription factor MYB86
SwissprotQ8LPH61e-49MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A059VP368e-58A0A059VP36_9POAL; MYB transcription factor 83 (Fragment)
TrEMBLA0A0C6WCR21e-56A0A0C6WCR2_9POAL; ScMYB11 protein
TrEMBLK3XI431e-56K3XI43_SETIT; Uncharacterized protein
STRINGSi001565m3e-56(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-53myb domain protein 61